Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSS RYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSR GGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLIN LFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV ARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNK MTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYL TKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTT SETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFI QTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNY KEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQ IVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGD LVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADN GGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEY AVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
    • Molecular weight
      85 kDa including tags
    • Amino acids
      53 to 750
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    1140 pmol/min/µg (9 ng NEP were used to cleave 10µM Mca-RPPGFSAFK(Dnp)-OH (Fluorogenic Substrate) at 37°C in 50 mM TRIS, pH 9.0).
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    ab157051 has been purified in the glycosylated soluble form.
  • Form
    Liquid
  • Additional notes
    Stable on ice for at least 1h. Do not freeze in dilute form.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.61% Tris, 20% Glycerol, 1.75% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Atriopeptidase
    • CALLA
    • CD10
    • CD10 antigen
    • Common acute lymphocytic leukemia antigen
    • DKFZp686O16152
    • EC 3.4.24.11
    • Enkephalinase
    • EPN
    • Membrane metallo endopeptidase
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase)
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10)
    • Membrane metallo endopeptidase variant 1
    • Membrane metallo endopeptidase variant 2
    • Membrane metalloendopeptidase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10
    • Membrane metalloendopeptidase variant 1
    • Membrane metalloendopeptidase variant 2
    • MGC126681
    • MGC126707
    • MME
    • NEP
    • NEP_HUMAN
    • Neprilysin
    • neprilysin-390
    • neprilysin-411
    • Neutral endopeptidase
    • Neutral endopeptidase 24.11
    • Neutral endopeptidase, membrane-associated
    • SFE
    • Skin fibroblast elastase
    see all
  • Function
    Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
  • Sequence similarities
    Belongs to the peptidase M13 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE Analysis of 1.0 μg of purified ab157051.

References

ab157051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up