Description

  • Product name

    Recombinant Human CD10 protein (His tag)
    See all CD10 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIP ETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESA IDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKK VLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDF MISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPML LYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYA PEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKAL YGTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIR EVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYL ELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSS GRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFN KDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGEN IADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTY RPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCR VWHHHHHH
    • Predicted molecular weight

      81 kDa including tags
    • Amino acids

      52 to 750
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab223024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% PMSF, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Atriopeptidase
    • CALLA
    • CD10
    • CD10 antigen
    • Common acute lymphocytic leukemia antigen
    • DKFZp686O16152
    • EC 3.4.24.11
    • Enkephalinase
    • EPN
    • Membrane metallo endopeptidase
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase)
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10)
    • Membrane metallo endopeptidase variant 1
    • Membrane metallo endopeptidase variant 2
    • Membrane metalloendopeptidase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10
    • Membrane metalloendopeptidase variant 1
    • Membrane metalloendopeptidase variant 2
    • MGC126681
    • MGC126707
    • MME
    • NEP
    • NEP_HUMAN
    • Neprilysin
    • neprilysin-390
    • neprilysin-411
    • Neutral endopeptidase
    • Neutral endopeptidase 24.11
    • Neutral endopeptidase, membrane-associated
    • SFE
    • Skin fibroblast elastase
    see all
  • Function

    Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
  • Sequence similarities

    Belongs to the peptidase M13 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 3 μg ab223024 analysed by 15% SDS-PAGE.

References

ab223024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up