Description

  • Product name

    Recombinant human CD105 protein
    See all CD105 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity: > 95% (SDS-PAGE and visualized by Silverstain)
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGP SQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLV TFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLP GHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTG EYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEA VVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPE GDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNII SPDLSGCTSHHHHHH
    • Amino acids

      26 to 584
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab54338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in PBS or medium to a concentration not lower than 50 µg/ml.

General Info

  • Alternative names

    • AI528660
    • AI662476
    • CD 105
    • CD105
    • CD105 antigen
    • EGLN_HUMAN
    • END
    • Endoglin
    • Eng
    • FLJ41744
    • HHT1
    • ORW
    • ORW1
    • Osler Rendu Weber syndrome 1
    • RP11 228B15.2
    • S endoglin
    • S-endoglin
    • SN6
    see all
  • Function

    Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors.
  • Tissue specificity

    Endoglin is restricted to endothelial cells in all tissues except bone marrow.
  • Involvement in disease

    Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE of recombinant human soluble CD105 fragment. The sample was loaded in 10% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.

  • Standard Curve for CD105 (Analyte: CD105 protein (ab54338)); dilution range 1pg/ml to 1ug/ml using Capture Antibody Mouse monoclonal [MEM-226] to CD105 (ab2529) at 5ug/ml and Detector Antibody Rabbit polyclonal to CD105 (ab21224) at 0.5ug/ml.

References

ab54338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The protein was dialyzed against PBS and then lyophilized.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up