Description

  • Product name

    Recombinant human CD116 protein (Active)
    See all CD116 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit GM-CSF dependent proliferation of TF1 human erythroleukemic cells. The ED50 for this effect is less or equal to 10 µg/ml in the presence of 0.5 ng/ml GM-CSF.

  • Purity

    > 90 % SDS-PAGE.
    ab227418 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKK NRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGR EGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCP YYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIE RFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGT ENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFG SDDGHHHHHH
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      20 to 320
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001155003.

Specifications

Our Abpromise guarantee covers the use of ab227418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as GM-CSF Receptor alpha

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CD_antigen=CD116
    • CD116
    • CD116 antigen
    • CDw116
    • Colony stimulating factor 2 receptor alpha chain
    • Colony stimulating factor 2 receptor alpha low affinity
    • Colony stimulating factor 2 receptor alpha subunit
    • CSF 2R
    • CSF2R
    • CSF2R_HUMAN
    • CSF2RA
    • CSF2RAX
    • CSF2RAY
    • CSF2RX
    • CSF2RY
    • GM CSF R alpha
    • GM CSF receptor alpha subunit
    • GM-CSF-R-alpha
    • GMCSFR
    • GMCSFR-alpha
    • GMR-alpha
    • Granulocyte macrophage colony stimulating factor receptor alpha chain
    • Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
    • SMDP4
    see all
  • Function

    Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
  • Involvement in disease

    Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) [MIM:300770]. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227418.

    MW 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab227418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up