Overview

Description

  • Nature
    Recombinant
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTT PSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGL YVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDI DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYME GNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP KDLTALSN MLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGV LIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPD FNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNL VTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDA LASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQ GLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMG FPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQ DYWLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQR DHSAIPVINRAQ IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWE AALSSLSYFKLMFDRSEVYGPMKN YLKKQVTPLFIHFRNNTNNWREIP ENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM ENPNNNPIHPNL RSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFND YGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALE QALEKTKANIKWVKENKEVVLQ WFTENSK
    • Molecular weight
      110 kDa
    • Amino acids
      1 to 967
    • Additional sequence information
      Purified from human serum

Specifications

Our Abpromise guarantee covers the use of ab134454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The active enzyme is inhibited by Amastatin hydrochloride, Actinonin and Bestatin hydrochloride (approx 150 µM). Specific activity of ab134454 is >500 mU/mg (L-Leu-pNA at 37°C, pH 7.2)

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes
    ab134454 is certified to be negative for HBsAg and for antibodies to HIV and HCV.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 0.01% Calcium chloride, 0.32% Tris HCl, 2.92% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Alanyl (membrane) aminopeptidase
    • Alanyl aminopeptidase
    • Aminopeptidase M
    • Aminopeptidase N
    • AMPN_HUMAN
    • ANPEP
    • AP M
    • AP N
    • AP-M
    • AP-N
    • APN
    • CD 13
    • CD13
    • CD13 antigen
    • gp150
    • hAPN
    • LAP 1
    • LAP1
    • Microsomal aminopeptidase
    • Myeloid plasma membrane glycoprotein CD13
    • p150
    • PEPN
    see all
  • Function
    Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types including small intestinal and tubular epithelial cells, macrophages, granulocytes and synaptic membranes from the CNS. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.
  • Tissue specificity
    Expressed in epithelial cells of the kidney, intestine, and respiratory tract; granulocytes, monocytes, fibroblasts, endothelial cells, cerebral pericytes at the blood-brain barrier, synaptic membranes of cells in the CNS. Also expressed in endometrial stromal cells, but not in the endometrial glandular cells. Found in the vasculature of tissues that undergo angiogenesis and in malignant gliomas and lymph node metastases from multiple tumor types but not in blood vessels of normal tissues. A soluble form has been found in plasma. It is found to be elevated in plasma and effusions of cancer patients.
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Domain
    Amino acids 260-353 are essential to mediate susceptibility to infection with HCoV-229E (in porcine/human chimeric studies) and more specifically amino acids 288-295 (mutagenesis studies).
  • Post-translational
    modifications
    Sulfated.
    N- and O-glycosylated.
    May undergo proteolysis and give rise to a soluble form.
  • Cellular localization
    Cell membrane. Cytoplasm > cytosol. A soluble form has also been detected.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab134454 at 0.5µg (lane 1) and 1.0 µg (lane 2).

References

ab134454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up