Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHF TIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
    • Molecular weight

      37 kDa including tags
    • Amino acids

      23 to 122

Specifications

Our Abpromise guarantee covers the use of ab114303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD130
    • CD130 antigen
    • CDw130
    • gp130
    • GP130 RAPS
    • IL 6R beta
    • IL-6 receptor subunit beta
    • IL-6R subunit beta
    • IL-6R-beta
    • IL-6RB
    • IL6 ST
    • IL6RB_HUMAN
    • IL6ST
    • Interleukin 6 receptor subunit beta
    • Interleukin receptor beta chain
    • Interleukin-6 receptor subunit beta
    • Interleukin-6 signal transducer
    • Membrane glycoprotein 130
    • Membrane glycoprotein gp130
    • Oncostatin M receptor
    • Oncostatin M receptor alpha subunit
    • Oncostatin-M receptor subunit alpha
    see all
  • Function

    Signal-transducing molecule. The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize gp130 for initiating signal transmission. Binds to IL6/IL6R (alpha chain) complex, resulting in the formation of high-affinity IL6 binding sites, and transduces the signal. Does not bind IL6. May have a role in embryonic development (By similarity). The type I OSM receptor is capable of transducing OSM-specific signaling events.
  • Tissue specificity

    Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    Phosphorylation of Ser-782 down-regulates cell surface expression.
    Heavily N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114303 at approx 36.63 kDa. Stained with Coomassie Blue.

References

ab114303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up