Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKP CKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPP
    • Amino acids
      31 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACT 35
    • ACT35
    • ACT35 antigen
    • ATC35 antigen
    • CD 134
    • CD134
    • CD134 antigen
    • IMD16
    • Lymphoid activation antigene ACT35
    • OX 40
    • OX40
    • OX40 antigen
    • OX40 cell surface antigen
    • OX40 homologue
    • OX40L receptor
    • TAX transcriptionally activated glycoprotein 1 receptor
    • TAX transcriptionally-activated glycoprotein 1 receptor
    • TNF receptor superfamily member 4
    • TNFRSF 4
    • TNFRSF4
    • TNR4_HUMAN
    • Tumor necrosis factor receptor superfamily member 4
    • Txgp 1l
    • Txgp1
    • Txgp1l
    see all
  • Function
    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities
    Contains 4 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159765 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up