Recombinant Human CD134 / OX40L receptor protein (His tag) (ab216258)

Description

  • Product name

    Recombinant Human CD134 / OX40L receptor protein (His tag)
    See all CD134 / OX40L receptor proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      51 to 183
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_003326.

Specifications

Our Abpromise guarantee covers the use of ab216258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.63% Tris HCl

General Info

  • Alternative names

    • ACT 35
    • ACT35
    • ACT35 antigen
    • ATC35 antigen
    • CD 134
    • CD134
    • CD134 antigen
    • IMD16
    • Lymphoid activation antigene ACT35
    • OX 40
    • OX40
    • OX40 antigen
    • OX40 cell surface antigen
    • OX40 homologue
    • OX40L receptor
    • TAX transcriptionally activated glycoprotein 1 receptor
    • TAX transcriptionally-activated glycoprotein 1 receptor
    • TNF receptor superfamily member 4
    • TNFRSF 4
    • TNFRSF4
    • TNR4_HUMAN
    • Tumor necrosis factor receptor superfamily member 4
    • Txgp 1l
    • Txgp1
    • Txgp1l
    see all
  • Function

    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 3 μg ab216258.

    This protein runs at a higher MW by SDS-PAGE due to glycosylation.

References

ab216258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up