Description

  • Product name

    Recombinant Human CD137 protein (Biotin)
    See all CD137 proteins and peptides
  • Purity

    >= 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGLNDIFEAQKIEWHE
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      24 to 186
    • Additional sequence information

      Topological domain (extracellular). GenBank Accession No. NM_001561.
  • Conjugation

    Biotin

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab198465 is useful for studying protein binding and screening small molecules.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • 4 1BB
    • 4 1BB ligand receptor
    • 4-1BB ligand receptor
    • 4-1BB Ligand Receptor T Cell
    • 4-1BB, mouse, homolog of
    • Antigen 4-1BB Homolog
    • CD 137
    • CD137
    • CD137 antigen
    • CDw137
    • HLDA VI
    • Homolog of mouse 4 1BB
    • ILA
    • Induced by lymphocyte activation
    • induced by lymphocyte activation (ILA)
    • Interleukin activated receptor homolog of mouse Ly63
    • Ly63, mouse, homolog of
    • MGC2172
    • OTTHUMP00000044294
    • Receptor protein 4 1BB
    • T cell antigen 4 1BB homolog
    • T cell antigen ILA
    • T-cell antigen 4-1BB homolog
    • T-cell antigen ILA
    • TNF receptor superfamily member 9
    • TNFRSF9
    • TNR9_HUMAN
    • Tumor necrosis factor receptor superfamily member 9
    see all
  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS PAGE analysis of 2.8 μg ab198465 stained with Coomassie.

References

ab198465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up