Description

  • Product name

    Recombinant human CD137 protein (Fc Chimera Active)
    See all CD137 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQC KGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCK DCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPG ASSVTPPAPAREPGHS
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      19 to 184
    • Additional sequence information

      The extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a (AAH06196.1).

Specifications

Our Abpromise guarantee covers the use of ab215031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute 100 µg vial with 100 µL sterile water to a concentration of 1mg/ml. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • 4 1BB
    • 4 1BB ligand receptor
    • 4-1BB ligand receptor
    • 4-1BB Ligand Receptor T Cell
    • 4-1BB, mouse, homolog of
    • Antigen 4-1BB Homolog
    • CD 137
    • CD137
    • CD137 antigen
    • CDw137
    • HLDA VI
    • Homolog of mouse 4 1BB
    • ILA
    • Induced by lymphocyte activation
    • induced by lymphocyte activation (ILA)
    • Interleukin activated receptor homolog of mouse Ly63
    • Ly63, mouse, homolog of
    • MGC2172
    • OTTHUMP00000044294
    • Receptor protein 4 1BB
    • T cell antigen 4 1BB homolog
    • T cell antigen ILA
    • T-cell antigen 4-1BB homolog
    • T-cell antigen ILA
    • TNF receptor superfamily member 9
    • TNFRSF9
    • TNR9_HUMAN
    • Tumor necrosis factor receptor superfamily member 9
    see all
  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up