Description

  • Product name

    Recombinant human CD137 protein (Fc Chimera Active)
    See all CD137 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQC KGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCK DCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPG ASSVTPPAPAREPGHS
    • Predicted molecular weight

      28 kDa
    • Amino acids

      19 to 184
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of human IgG1. NCBI Accession No. AAH06196.1.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab216185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at +4°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • 4 1BB
    • 4 1BB ligand receptor
    • 4-1BB ligand receptor
    • 4-1BB Ligand Receptor T Cell
    • 4-1BB, mouse, homolog of
    • Antigen 4-1BB Homolog
    • CD 137
    • CD137
    • CD137 antigen
    • CDw137
    • HLDA VI
    • Homolog of mouse 4 1BB
    • ILA
    • Induced by lymphocyte activation
    • induced by lymphocyte activation (ILA)
    • Interleukin activated receptor homolog of mouse Ly63
    • Ly63, mouse, homolog of
    • MGC2172
    • OTTHUMP00000044294
    • Receptor protein 4 1BB
    • T cell antigen 4 1BB homolog
    • T cell antigen ILA
    • T-cell antigen 4-1BB homolog
    • T-cell antigen ILA
    • TNF receptor superfamily member 9
    • TNFRSF9
    • TNR9_HUMAN
    • Tumor necrosis factor receptor superfamily member 9
    see all
  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab216185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up