Description

  • Product name

    Recombinant Human CD146 protein (Fc Chimera)
    See all CD146 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKRTLI FRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRS QEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVI WYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYC ELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCL ADGNPPPHFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGL DLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSSLTLTCEAESSQDL EFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRTQLV NVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQ DQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLT PDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRG
    • Predicted molecular weight

      86 kDa including tags
    • Amino acids

      24 to 599
    • Additional sequence information

      ab174021 Fc Chimera, fused with Fc fragment of Human IgG1 at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -70°C.

General Info

  • Alternative names

    • A32 antigen
    • CD 146
    • CD146
    • CD146 antigen
    • Cell surface glycoprotein MUC18
    • Cell surface glycoprotein P1H12
    • Gicerin
    • Mcam
    • Melanoma adhesion molecule
    • Melanoma associated antigen A32
    • Melanoma associated antigen MUC18
    • Melanoma associated glycoprotein MUC18
    • Melanoma cell adhesion molecule
    • Melanoma-associated antigen A32
    • Melanoma-associated antigen MUC18
    • MelCAM
    • MUC 18
    • MUC18
    • MUC18_HUMAN
    • S endo 1
    • S endo 1 endothelial associated antigen
    • S-endo 1 endothelial-associated antigen
    see all
  • Function

    Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2, and a transient increase in the intracellular calcium concentration.
  • Tissue specificity

    Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174021 staining overnight with Coomassie Blue.

     

References

ab174021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up