Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALP GQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINE GETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSE LHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLALEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight

      48 kDa including tags
    • Amino acids

      22 to 207
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused to hIgG-His-tag at the C-terminus (NP_940991).

Specifications

Our Abpromise guarantee covers the use of ab229371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab229371 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • 5A11 antigen
    • 5F7
    • BASI_HUMAN
    • Basigin
    • Basigin (Ok blood group)
    • Blood brain barrier HT7 antigen
    • Bsg
    • CD 147
    • CD147
    • CD147 antigen
    • Collagenase stimulatory factor
    • EMMPRIN
    • Extracellular matrix metalloproteinase inducer
    • Leukocyte activation antigen M6
    • M 6
    • M6
    • M6 leukocyte activation antigen
    • Neurothelin
    • OK
    • OK blood group
    • OK blood group antigen
    • TCSF
    • Tumor cell derived collagenase stimulatory factor
    • Tumor cell-derived collagenase stimulatory factor
    see all
  • Function

    Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
  • Tissue specificity

    Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Melanosome. Colocalizes with SLC16A1 and SLC16A8 (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229371.

    MW: 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab229371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up