Bioactive grade

Recombinant human CD16 protein (Active) (Biotin) (ab246090)

Description

  • Product name

    Recombinant human CD16 protein (Active) (Biotin)
    See all CD16 proteins and peptides
  • Biological activity

    Assay 1: ab246090 captured on a Biotin CAP- Series S Sensor Chip can bind Rituximab with an affinity constant of 0.261 μM as determined in a SPR assay (Biacore T200). 

    Assay 2: ab246090 on a SA Chip can bind Rituximab with an affinity constant of 0.3 μM as determined in a SPR assay (Biacore T200).

  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKD SGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      17 to 208
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Biotinylation is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. AviTag: sequence GLNDIFEAQKIEWHE. Extracellular domain.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CD 16
    • CD 16a
    • CD16
    • CD16a
    • CD16a antigen
    • CD16B
    • CD16b antigen
    • Fc fragment of IgG
    • Fc fragment of IgG low affinity IIIa receptor
    • Fc fragment of IgG low affinity IIIa receptor (CD16)
    • Fc fragment of IgG receptor IIIa
    • Fc fragment of IgG, low affinity III, receptor (CD16)
    • Fc fragment of IgG, low affinity III, receptor for (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
    • Fc fragment of IgG, low affinity IIIa, receptor for
    • Fc fragment of IgG, low affinity IIIb, receptor (CD16b)
    • Fc fragment of IgG, low affinity IIIb, receptor for (CD16)
    • Fc gamma R3
    • Fc gamma receptor III 2 (CD 16)
    • Fc gamma receptor III A
    • Fc gamma receptor IIIA
    • Fc gamma receptor IIIb (CD 16)
    • Fc gamma RIII
    • Fc gamma RIII alpha
    • Fc gamma RIII beta
    • Fc gamma RIIIa
    • Fc gamma RIIIb
    • Fc of IgG
    • Fc-gamma receptor III2 (CD 16)
    • Fc-gamma receptor III2 (CD16)
    • Fc-gamma receptor IIIb (CD16)
    • Fc-gamma RIII
    • Fc-gamma RIII-alpha
    • Fc-gamma RIIIa
    • FCG 3
    • FCG3
    • FCG3A_HUMAN
    • FCgammaRIIIA
    • FCGR 3
    • FCGR 3A
    • FCGR3
    • FCGR3A
    • FCGR3A protein
    • FCGRIII
    • FCGRIII-2
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIa
    • IGFR 3
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III 2
    • IgG Fc receptor III-2
    • IMD20
    • immunoglobulin G Fc receptor III
    • immunoglobulin G Fc receptor III-2
    • Low affinity IIIa receptor
    • Low affinity immunoglobulin gamma Fc region receptor III A
    • Low affinity immunoglobulin gamma Fc region receptor III-A
    • Low affinity immunoglobulin gamma Fc region receptor IIIB
    • neutrophil-specific antigen NA
    see all
  • Function

    Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
  • Tissue specificity

    Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Glycosylated. Contains high mannose- and complex-type oligosaccharides.
    The soluble form is produced by a proteolytic cleavage.
  • Cellular localization

    Cell membrane. Secreted. Exists also as a soluble receptor.
  • Information by UniProt

Images

  • Loaded Biotinylated Human CD16a (V176),�Avitag,His Tag (SPR�& BLI verified) on SA Biosensor, can bind Rituximab with an affinity constant of 0.316 µM as determined in BLI assay.
  • SDS-PAGE analysis of ab246090 under reducing conditions.

    The protein has a calculated MW of 25.5 kDa. The protein migrates as 40-55 kDa under reducing conditions due to glycosylation.

  • ab246090 on a SA Chip can bind Rituximab with an affinity constant of 0.3 μM as determined in a SPR assay (Biacore T200).

  • ab246090 captured on a Biotin CAP- Series S Sensor Chip can bind Rituximab with an affinity constant of 0.261 μM as determined in a SPR assay (Biacore T200).

References

ab246090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up