Bioactive grade

Recombinant human CD16 protein (Biotin) (ab207125)

Description

  • Product name

    Recombinant human CD16 protein (Biotin)
    See all CD16 proteins and peptides
  • Biological activity

    The bioactivity is measured by its binding ability to Ipilimumab in a SPR assay. Immobilized ab207125 can bind Ipilimumab with affinity constant of around 784 nM.

  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKD SGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      17 to 208
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab207125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitagtechnology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Store In the Dark.

    pH: 7.40
    Constituent: 95% PBS

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile deionized water. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 16
    • CD 16a
    • CD16
    • CD16a
    • CD16a antigen
    • CD16B
    • CD16b antigen
    • Fc fragment of IgG
    • Fc fragment of IgG low affinity IIIa receptor
    • Fc fragment of IgG low affinity IIIa receptor (CD16)
    • Fc fragment of IgG receptor IIIa
    • Fc fragment of IgG, low affinity III, receptor (CD16)
    • Fc fragment of IgG, low affinity III, receptor for (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
    • Fc fragment of IgG, low affinity IIIa, receptor for
    • Fc fragment of IgG, low affinity IIIb, receptor (CD16b)
    • Fc fragment of IgG, low affinity IIIb, receptor for (CD16)
    • Fc gamma R3
    • Fc gamma receptor III 2 (CD 16)
    • Fc gamma receptor III A
    • Fc gamma receptor IIIA
    • Fc gamma receptor IIIb (CD 16)
    • Fc gamma RIII
    • Fc gamma RIII alpha
    • Fc gamma RIII beta
    • Fc gamma RIIIa
    • Fc gamma RIIIb
    • Fc of IgG
    • Fc-gamma receptor III2 (CD 16)
    • Fc-gamma receptor III2 (CD16)
    • Fc-gamma receptor IIIb (CD16)
    • Fc-gamma RIII
    • Fc-gamma RIII-alpha
    • Fc-gamma RIIIa
    • FCG 3
    • FCG3
    • FCG3A_HUMAN
    • FCgammaRIIIA
    • FCGR 3
    • FCGR 3A
    • FCGR3
    • FCGR3A
    • FCGR3A protein
    • FCGRIII
    • FCGRIII-2
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIa
    • IGFR 3
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III 2
    • IgG Fc receptor III-2
    • IMD20
    • immunoglobulin G Fc receptor III
    • immunoglobulin G Fc receptor III-2
    • Low affinity IIIa receptor
    • Low affinity immunoglobulin gamma Fc region receptor III A
    • Low affinity immunoglobulin gamma Fc region receptor III-A
    • Low affinity immunoglobulin gamma Fc region receptor IIIB
    • neutrophil-specific antigen NA
    see all
  • Function

    Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
  • Tissue specificity

    Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Glycosylated. Contains high mannose- and complex-type oligosaccharides.
    The soluble form is produced by a proteolytic cleavage.
  • Cellular localization

    Cell membrane. Secreted. Exists also as a soluble receptor.
  • Information by UniProt

Images

  • Immobilized Biotinylated Human CD16a (F176), Avitag,His Tag (SPR & BLI verified) on SA Chip can bind Rituximab with an affinity constant of 1.33 µM as determined in a SPR assay (Biacore T200).

  • Biotinylated Human CD16a (F176), Avitag,His Tag (SPR & BLI verified) captured on Biotin CAP- Series S Sensor Chip can bind Rituximab with an affinity constant of 1.72 µM as determined in a SPR assay (Biacore T200).

  • Biotinylated Human CD16a (F176), Avitag,His Tag (SPR�& BLI verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Loaded Biotinylated Human CD16a (F176), Avitag,His Tag (SPR & BLI verified) on SA Biosensor, can bind Rituximab with an affinity constant of 1.29 µM as determined in BLI assay.

  • SDS-PAGE analysis of reduced ab207125 stained overnight with Coomassie Blue.

    Note: The reducing protein migrates as 40-55 kDa in SDS-PAGE due to glycosylation.

References

ab207125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up