Description

  • Product name

    Recombinant Human CD166 protein (His tag)
    See all CD166 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKS VQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTI VKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVL HPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGP SGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPP PEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAI TVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSP SFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPS GLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISP EENVTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQA
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      28 to 526
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_001618).

Specifications

Our Abpromise guarantee covers the use of ab220576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Activated leukocyte cell adhesion molecule
    • ALCAM
    • ALCAM protein
    • CD 166
    • CD166
    • CD166 antigen
    • CD166_HUMAN
    • FLJ3851
    • FLJ38514
    • MEMD
    • MGC71733
    see all
  • Function

    Cell adhesion molecule that binds to CD6. Involved in neurite extension by neurons via heterophilic and homophilic interactions. May play a role in the binding of T- and B-cells to activated leukocytes, as well as in interactions between cells of the nervous system.
  • Tissue specificity

    Spleen, placenta, liver, and weakly in liver. Expressed by activated T-cells, B-cells, monocytes and thymic epithelial cells. Expressed by neurons in the brain. Restricted expression in tumor cell lines. Preferentially expressed in highly metastasizing melanoma cell lines.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Domain

    The CD6 binding site is located in the N-terminal Ig-like domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220576 stained overnight with Coomassie Blue.

    The reducing protein migrates as 65-80 kDa due to glycosylation.

References

ab220576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up