Description

  • Product name

    Recombinant Human CD16b protein
    See all CD16b proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISS QASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFK EEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGS YFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      20 to 208
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused with a FC-6His tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • CD16
    • CD16b
    • CD16b antigen
    • Fc fragment of IgG low affinity IIIb receptor
    • Fc gamma receptor IIIb
    • Fc gamma RIII
    • Fc gamma RIII beta
    • Fc gamma RIIIb
    • Fc-gamma RIII
    • Fc-gamma RIII-beta
    • Fc-gamma RIIIb
    • FCG3
    • FCG3B_HUMAN
    • FCGR3
    • FCGR3B
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIb
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III-1
    • Low affinity immunoglobulin gamma Fc region receptor III B
    • Low affinity immunoglobulin gamma Fc region receptor III-B
    see all
  • Information by UniProt

References

ab191919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up