Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKD SGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
    • Molecular weight

      22 kDa including tags
    • Amino acids

      17 to 200
    • Tags

      His tag C-Terminus
    • Additional sequence information

      AAI28563.1.

Specifications

Our Abpromise guarantee covers the use of ab174010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to bind Human IgG with an estimated KD < 150 nM.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • CD16
    • CD16b
    • CD16b antigen
    • Fc fragment of IgG low affinity IIIb receptor
    • Fc gamma receptor IIIb
    • Fc gamma RIII
    • Fc gamma RIII beta
    • Fc gamma RIIIb
    • Fc-gamma RIII
    • Fc-gamma RIII-beta
    • Fc-gamma RIIIb
    • FCG3
    • FCG3B_HUMAN
    • FCGR3
    • FCGR3B
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIb
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III-1
    • Low affinity immunoglobulin gamma Fc region receptor III B
    • Low affinity immunoglobulin gamma Fc region receptor III-B
    see all
  • Information by UniProt

Images

  • Immobilized Human CD16b (NA2), His Tag (SPR�& BLI verified) on CM5 Chip via anti-His antibody, can bind Rituximab with an affinity constant of 2.88 µM as determined in a SPR assay (Biacore T200).
  • Human CD16b (NA2), His Tag (SPR�& BLI verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Loaded Human CD16b (NA2), His Tag (SPR�& BLI verified) on HIS1K Biosensor, can bind Rituximab with an affinity constant of 7.1 µM as determined in BLI assay.
  • SDS-PAGEanalysis of reduced ab174010 stained overnight with Coomassie Blue.

    Protein migrates as 38-50 kDa due to glycosylation.

References

ab174010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up