Bioactive grade

Recombinant human CD16b protein (Active) (Biotin) (ab246039)

Description

  • Product name

    Recombinant human CD16b protein (Active) (Biotin)
    See all CD16b proteins and peptides
  • Biological activity

    Assay #1: ab246039 captured on Biotin CAP-Series S Sensor Chip can bind Herceptin with an affinity constant of 8.32 μM as determined in a SPR assay (QC tested). 

    Assay #2: ab246039 on SA Chip, can bind Herceptin with an affinity constant of 3.31 μM as determined in a SPR assay (Routinely tested). 

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKD SGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      17 to 200
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Without signal peptide, without propeptide. AviTag sequence: GLNDIFEAQKIEWHE
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 mins at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CD16
    • CD16b
    • CD16b antigen
    • Fc fragment of IgG low affinity IIIb receptor
    • Fc gamma receptor IIIb
    • Fc gamma RIII
    • Fc gamma RIII beta
    • Fc gamma RIIIb
    • Fc-gamma RIII
    • Fc-gamma RIII-beta
    • Fc-gamma RIIIb
    • FCG3
    • FCG3B_HUMAN
    • FCGR3
    • FCGR3B
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIb
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III-1
    • Low affinity immunoglobulin gamma Fc region receptor III B
    • Low affinity immunoglobulin gamma Fc region receptor III-B
    see all
  • Information by UniProt

Images

  • Loaded Biotinylated Human CD16b (NA1), His,Avitag (SPR�& BLI verified) on SA Biosensor, can bind Rituximab with an affinity constant of 7.7 µM as determined in BLI assay.
  • SDS-PAGE - Recombinant human CD16b protein (Active) (Biotin) (ab246039).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. The protein migrates as 38-48 KDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • ab246039 captured on Biotin CAP-Series S Sensor Chip can bind Herceptin with an affinity constant of 8.32 μM as determined in a SPR assay (QC tested).

  • ab246039 captured on SA Chip, can bind Herceptin with an affinity constant of 3.31 μM as determined in a SPR assay (Routinely tested).

References

ab246039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up