Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPE NVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEV AHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYP QSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLT CQVKHDGQLAVSKRLALEVTVHQKDQSSDATPGPAS
    • Molecular weight

      64 kDa including tags
    • Amino acids

      29 to 364
    • Additional sequence information

      Fused with Fc fragment of Human IgG1 at the C-terminus (AAH64532.1).

Specifications

Our Abpromise guarantee covers the use of ab191638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.5
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD172 antigen like family member B
    • bA77C3.1
    • CD172 antigen-like family member B
    • CD172g
    • CD172g antigen
    • FLJ42230
    • RP11-77C3.2
    • Signal regulatory protein beta 2
    • Signal regulatory protein gamma
    • Signal-regulatory protein beta-2
    • Signal-regulatory protein gamma
    • SIRP B2
    • SIRP beta 2
    • SIRP gamma
    • SIRP-b2
    • SIRP-beta-2
    • SIRP-gamma
    • SIRPB2
    • SIRPG
    • SIRPG_HUMAN
    • SIRPgamma
    see all
  • Function

    Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
  • Tissue specificity

    Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. Mainly present in the paracortical T-cell area of lymph nodes, with only sparse positive cells in the mantle and in the germinal center of B-cell follicles. In the thymus, primarily expressed in the medulla on mature T lymphocytes that have undergone thymic selection.
  • Sequence similarities

    Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab191638 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 68-75 kDa due to glycosylation.

References

ab191638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up