Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKEITNALETWGALGQDINL DIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLK IKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTT LTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVS KESSVEPVSCPEKGLD
    • Molecular weight

      25 kDa including tags
    • Amino acids

      25 to 209
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134855 was constructed with a 31 N terminal T7/His tag and expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer contains a proprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • CD 2
    • CD2
    • CD2 antigen
    • CD2 antigen (p50), sheep red blood cell receptor
    • CD2 molecule
    • CD2_HUMAN
    • Erythrocyte receptor
    • FLJ46032
    • LFA-2
    • LFA-3 receptor
    • LFA2
    • LFA3 receptor
    • Ly-37
    • Lymphocyte function antigen 2
    • lymphocyte-function antigen-2
    • OTTHUMP00000024366
    • Rosette receptor
    • Sheep erythrocyte receptor
    • SRBC
    • T cell surface antigen CD2
    • T-cell surface antigen CD2
    • T-cell surface antigen T11/Leu-5
    • T-lymphocyte surface CD2 antigen
    • T11
    see all
  • Function

    CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab134855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up