Recombinant human CD2 protein (Active) (ab174026)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CD2 protein (Active)
See all CD2 proteins and peptides -
Biological activity
Immobilized Human CD58, Fc Tag at 5 μg/mL (100 μL/well) can bind ab174026 with a linear range of 39-312 ng/mL (QC tested).
-
Purity
> 95 % SDS-PAGE.
Purified by Immobilized metal affinity chromatography. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKE KETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDL KIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITH KWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLD -
Predicted molecular weight
23 kDa including tags -
Molecular weight information
The protein has a calculated MW of 22.3 kDa. The protein migrates as 33-40 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. -
Amino acids
25 to 209 -
Tags
His tag C-Terminus -
Additional sequence information
Extracellular domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab174026 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- CD 2
- CD2
- CD2 antigen
see all -
Function
CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Membrane. - Information by UniProt
Images
-
ab174026 on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized Human CD58, Fc Tag at 5 μg/mL (100 μL/well) can bind ab174026 with a linear range of 39-312 ng/mL (QC tested).
-
The purity of Human CD2, His Tag (ab174026) is more than 90% and the molecular weight of this protein is around 23-35 kDa verified by SEC-MALS.
-
Loaded bind Human CD58, Fc Tag on Protein A Biosensor, can bind Human CD2, His Tag (ab174026) with an affinity constant of 8.42 nM as determined in BLI assay (ForteBio Octet Red96e) (Routinely tested).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab174026 has not yet been referenced specifically in any publications.