Description

  • Product name

    Recombinant Human CD20 protein (His tag)
    See all CD20 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab229363 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQP KNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSPHHHHHH
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      210 to 297
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Product corresponds to the cytoplasmic domain. NP_068769

Specifications

Our Abpromise guarantee covers the use of ab229363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • APY
    • ATOPY
    • B lymphocyte antigen CD20
    • B Lymphocyte Cell Surface Antigen B1
    • B-lymphocyte antigen CD20
    • B-lymphocyte cell-surface antigen B1
    • B-lymphocyte surface antigen B1
    • B1
    • Bp 35
    • Bp35
    • CD 20
    • CD20
    • CD20 antigen
    • CD20 receptor
    • CD20_HUMAN
    • CVID 5
    • CVID5
    • Fc epsilon receptor I beta chain
    • Fc Fragment of IgE high affinity I receptor for beta polypeptide
    • FCER1B
    • High affinity immunoglobulin epsilon receptor subunit beta
    • IgE Fc receptor subunit beta
    • IGEL
    • IGER
    • IGHER
    • LEU 16
    • Leu-16
    • LEU16
    • leukocyte surface antigen Leu 16
    • Leukocyte surface antigen Leu-16
    • Ly44
    • Membrane spanning 4 domains A1
    • Membrane spanning 4 domains subfamily A member 2
    • membrane-spanning 4-domains A1
    • Membrane-spanning 4-domains subfamily A member 1
    • MGC3969
    • MS4A1
    • MS4A2
    • S7
    see all
  • Function

    This protein may be involved in the regulation of B-cell activation and proliferation.
  • Tissue specificity

    Expressed on B-cells.
  • Involvement in disease

    Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5) [MIM:613495]; also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Belongs to the MS4A family.
  • Post-translational
    modifications

    Phosphorylated. Might be functionally regulated by protein kinase(s).
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg recombinant human CD20 protein (His tag) (ab229363).

References

ab229363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up