Description

  • Product name

    Recombinant Human CD200 / OX2 protein (denatured)
    See all CD200 / OX2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSQVQVVTQDEREQLYTPASLKCSLQNAQ EALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTIT FWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLN ITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQ VGKEVICQVLHLGTVTDFKQTVNKG
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      31 to 232
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_005935.

Specifications

Our Abpromise guarantee covers the use of ab181947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • Antigen identified by monoclonal antibody MRC OX 2
    • CD200
    • CD200 antigen
    • CD200 molecule
    • MOX1
    • MOX2
    • MRC
    • MRC OX 2 antigen
    • My033
    • OX 2
    • OX 2 membrane glycoprotein precursor
    • OX-2 membrane glycoprotein
    • OX2G
    • OX2G_HUMAN
    see all
  • Function

    Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181947 (3μg).

References

ab181947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up