Description

  • Product name

    Recombinant Human CD200 / OX2 protein (Fc Chimera)
    See all CD200 / OX2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSE NHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGK ISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVN KG
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      31 to 232
    • Additional sequence information

      Extracellular domain. Accession # AAH22522. This protein carries a human IgG1 Fc tag (aa 100-330; P01857) at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab221234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Antigen identified by monoclonal antibody MRC OX 2
    • CD200
    • CD200 antigen
    • CD200 molecule
    • MOX1
    • MOX2
    • MRC
    • MRC OX 2 antigen
    • My033
    • OX 2
    • OX 2 membrane glycoprotein precursor
    • OX-2 membrane glycoprotein
    • OX2G
    • OX2G_HUMAN
    see all
  • Function

    Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab221234 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 50-68 kDa.

     

References

ab221234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up