Recombinant human CD200 / OX2 protein (Active) (ab174024)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSE NHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGK ISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVN KG
    • Molecular weight
      23 kDa including tags
    • Amino acids
      31 to 232
    • Tags
      His tag C-Terminus
    • Additional sequence information
      AAH22522. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab174024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab174024 at 2 μg/ml, the concentration that produces 50% of the optimal binding response is appoximately 0.5-16 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names
    • Antigen identified by monoclonal antibody MRC OX 2
    • CD200
    • CD200 antigen
    • CD200 molecule
    • MOX1
    • MOX2
    • MRC
    • MRC OX 2 antigen
    • My033
    • OX 2
    • OX 2 membrane glycoprotein precursor
    • OX-2 membrane glycoprotein
    • OX2G
    • OX2G_HUMAN
    see all
  • Function
    Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174024 staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 35-45 kDa due to glycosylation.

References

ab174024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up