Bioactive grade

Recombinant human CD200R protein (Active) (Biotin) (ab246107)

Description

  • Product name

    Recombinant human CD200R protein (Active) (Biotin)
    See all CD200R proteins and peptides
  • Biological activity

    Immobilized Human CD200, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246107 with a linear range of 0.5-7.8 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKM ATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYRKETNETKETNCTDE RITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTP EVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTVKST CHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      27 to 266
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      AAQ19772.1. Biotinylated using Avitag™ technology. Briefly, the single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD 200R
    • CD200 cell surface glycoprotein receptor
    • CD200 receptor 1
    • Cd200r1
    • Cell surface glycoprotein CD200 receptor 1
    • Cell surface glycoprotein OX2 receptor
    • Cell surface glycoprotein OX2 receptor 1
    • cell surface glycoprotein receptor CD200
    • CRTR 2
    • CRTR2
    • HCRTR2
    • MO2R1_HUMAN
    • MOX2 receptor
    • MOX2R
    • OX2R
    see all
  • Function

    Receptor for the CD200/OX2 cell surface glycoprotein. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
  • Tissue specificity

    Expressed in granulocytes, monocytes, most T cells, neutrophils, basophils and a subset of NK, NKT and B cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and mast cells.
  • Sequence similarities

    Belongs to the CD200R family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    The mature form of isoform 2 and/or isoform 4 starts at sequence position 27 of the corresponding isoform.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Reducing SDS-PAGE analysis of ab246107. The protein has a calculated MW of 55.8 kDa. The protein migrates as 70-115 KDa under reducing conditions due to glycosylation.

  • Immobilized Human CD200, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246107 with a linear range of 0.5-7.8 ng/mL.

References

ab246107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up