Description

  • Product name

    Recombinant Human CD200R protein (Tagged)
    See all CD200R proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKM ATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDE RITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTP EVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKST CHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      27 to 266
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      Contains an FC tag at the C-terminus. Please note: the sequence reported contains a natural variant at amino acid position 177, where a Glutamine (Q) is substituted by a Histidine (H).

Specifications

Our Abpromise guarantee covers the use of ab185859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • CD 200R
    • CD200 cell surface glycoprotein receptor
    • CD200 receptor 1
    • Cd200r1
    • Cell surface glycoprotein CD200 receptor 1
    • Cell surface glycoprotein OX2 receptor
    • Cell surface glycoprotein OX2 receptor 1
    • cell surface glycoprotein receptor CD200
    • CRTR 2
    • CRTR2
    • HCRTR2
    • MO2R1_HUMAN
    • MOX2 receptor
    • MOX2R
    • OX2R
    see all
  • Function

    Receptor for the CD200/OX2 cell surface glycoprotein. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
  • Tissue specificity

    Expressed in granulocytes, monocytes, most T cells, neutrophils, basophils and a subset of NK, NKT and B cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and mast cells.
  • Sequence similarities

    Belongs to the CD200R family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    The mature form of isoform 2 and/or isoform 4 starts at sequence position 27 of the corresponding isoform.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab185859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up