Description

  • Product name

    Recombinant Human CD204 protein (denatured)
    See all CD204 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSKWETKNCSVSSTNANDITQSLTGKGND SEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFN DILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQE NTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITND LRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGPIGPPG LKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFTKVRLV GGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAA HFGQGTGPIWLNEVFCFGRESSIEECKIRQWGTRACSHSEDAGVTCTL
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      77 to 451
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain (NP_619729).

Specifications

Our Abpromise guarantee covers the use of ab203525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Macrophage Scavenger Receptor I

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • CD204
    • CD204 antigen
    • CD24
    • Macrophage acetylated LDL receptor I and II
    • Macrophage scavenger receptor 1
    • Macrophage scavenger receptor type III
    • Macrophage scavenger receptor types I and II
    • Msr 1
    • MSR1
    • MSRE_HUMAN
    • phSR1
    • phSR2
    • SCARA 1
    • SCARA1
    • Scavenger receptor class A member 1
    • Scavenger receptor class A, member 1
    • Scavenger receptor type A
    • Scvr
    • SR A
    • SRA
    see all
  • Function

    Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL.
  • Tissue specificity

    Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
  • Sequence similarities

    Contains 1 collagen-like domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab203525 (3 μg).

References

ab203525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up