Description

  • Product name

    Recombinant human CD22 protein
    See all CD22 proteins and peptides
  • Biological activity

    The expected ED50 of 10-17 μg/ml is determined by its capability to inhibit proliferation of Raji cells.

  • Purity

    98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKF DGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRM ESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYP IQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQL QDADGKFLSNDTVQLNVKHTPKLEIKVTPSDA
    • Predicted molecular weight

      27 kDa
    • Amino acids

      22 to 253

Specifications

Our Abpromise guarantee covers the use of ab218568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • B cell receptor CD22 precursor
    • B lymphocyte cell adhesion molecule
    • B-cell receptor CD22
    • B-lymphocyte cell adhesion molecule
    • BL CAM
    • BL-CAM
    • BLCAM
    • CD 22
    • CD22
    • CD22 antigen
    • CD22 molecule
    • CD22 protein
    • CD22_HUMAN
    • Lectin 2
    • Leu14
    • Lyb8
    • MGC130020
    • sialic acid binding Ig like lectin 2
    • Sialic acid binding immunoglobulin like lectin 2
    • Sialic acid-binding Ig-like lectin 2
    • SIGLEC 2
    • Siglec-2
    • SIGLEC2
    • T cell surface antigen Leu 14
    • T-cell surface antigen Leu-14
    see all
  • Function

    Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
  • Tissue specificity

    B-lymphocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2.
    Phosphorylated on tyrosine residues by LYN.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab218568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up