Recombinant human CD22 protein (Active) (Biotin) (ab252370)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Avi tag C-Terminus, Fc tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CD22 protein (Active) (Biotin)
See all CD22 proteins and peptides -
Biological activity
Immobilized Anti-Human CD22 MAb at 0.5 μg/mL (100 μL/well) can bind ab252370 with a linear range of 1-16 ng/mL.
-
Purity
> 95 % SDS-PAGE.
The biotin to protein ratio is 0.5-1 as determined by the HABA assay. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTS KFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGL RMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYG YPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTC QLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSS SNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGR SEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHN GKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPP KKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGV LKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEI HSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSY SCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESD ANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGR SPLSTLTVYYSPETIGRR -
Predicted molecular weight
104 kDa including tags -
Amino acids
20 to 687 -
Tags
Avi tag C-Terminus , Fc tag C-Terminus -
Additional sequence information
Extracellular domain fused to human IgG1 Fc tag. AviTag sequence GLNDIFEAQKIEWHE.
-
-
Conjugation
Biotin
Specifications
Our Abpromise guarantee covers the use of ab252370 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
0.22 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- B cell receptor CD22 precursor
- B lymphocyte cell adhesion molecule
- B-cell receptor CD22
see all -
Function
Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. -
Tissue specificity
B-lymphocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. -
Post-translational
modificationsPhosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2.
Phosphorylated on tyrosine residues by LYN. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Functional Studies - Recombinant human CD22 protein (Active) (Biotin) (ab252370)
293 cells were transfected with anti-CD22-scFv and RFP tag. 2e5 of the cells were first stained with B. Biotinylated Human Siglec-2, Fc,Avitag and C. Biotinylated Protein Control, followed by FITC Streptavidin. A. Non-transfected 293 cells and C. Biotinylated Protein Control were used as negative control. RFP was used to evaluate CAR (anti-CD22-scFv) expression and FITC was used to evaluate the binding activity of Biotinylated Human Siglec-2, Fc,Avitag .
-
SDS-PAGE - Recombinant human CD22 protein (Active) (Biotin) (ab252370)SDS-PAGE - Recombinant human CD22 protein (Active) (Biotin) (ab252370).
The gel was stained overnight with Coomassie Blue.
The protein migrates as 115-120 kDa under reducing conditions due to glycosylation.
-
Functional Studies - Recombinant human CD22 protein (Active) (Biotin) (ab252370)Immobilized Anti-Human CD22 MAb at 0.5 μg/mL (100 μL/well) can bind ab252370 with a linear range of 1-16 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab252370 has not yet been referenced specifically in any publications.
