Description

  • Product name

    Recombinant Human CD22 protein (His tag)
    See all CD22 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDAD GKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYT TVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFL QVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQG RTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTV IQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNV GWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSV SLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNN SIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVS HYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTL TVYYSPETIGRR
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      176 to 687
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab217822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B cell receptor CD22 precursor
    • B lymphocyte cell adhesion molecule
    • B-cell receptor CD22
    • B-lymphocyte cell adhesion molecule
    • BL CAM
    • BL-CAM
    • BLCAM
    • CD 22
    • CD22
    • CD22 antigen
    • CD22 molecule
    • CD22 protein
    • CD22_HUMAN
    • Lectin 2
    • Leu14
    • Lyb8
    • MGC130020
    • sialic acid binding Ig like lectin 2
    • Sialic acid binding immunoglobulin like lectin 2
    • Sialic acid-binding Ig-like lectin 2
    • SIGLEC 2
    • Siglec-2
    • SIGLEC2
    • T cell surface antigen Leu 14
    • T-cell surface antigen Leu-14
    see all
  • Function

    Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
  • Tissue specificity

    B-lymphocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2.
    Phosphorylated on tyrosine residues by LYN.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE using ab217822. DTT-reduced protein migrates as 90-100 kDa in SDS-PAGE due to glycosylation.

References

ab217822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up