Recombinant human CD226 protein (Active) (ab219701)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human CD226 protein (Active)
See all CD226 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
Immobilized ab219701 at 2 μg/mL (100 μL/well) can bind Human CD155, Fc tag with a linear range of 3.3-51.2 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHG MVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTW QKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKI QPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSG LYRCYLQASAGENETFVMRLTVAEGKTDN -
Predicted molecular weight
28 kDa including tags -
Amino acids
19 to 247 -
Tags
His tag C-Terminus -
Additional sequence information
(NP_006557).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219701 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from 0.22 µm filtered solution.
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- adhesion glycoprotein
- CD226
- CD226 antigen
see all -
Function
Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. -
Tissue specificity
Expressed by peripheral blood T-lymphocytes. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human CD226 protein (Active) (ab219701)SDS-PAGE analysis of reduced ab219701 stained overnight with Coomassie Blue.
-
Functional Studies - Recombinant human CD226 protein (Active) (ab219701)Ab219701 at 3µg/ml can bind to 293T cell overexpressing human CD155 as dtermined by FACS assay.
-
Functional Studies - Recombinant human CD226 protein (Active) (ab219701)Immobilized ab219701 at 2 μg/mL (100 μL/well) can bind Human CD155, Fc tag with a linear range of 3.3-51.2 ng/mL.
Datasheets and documents
References
ab219701 has not yet been referenced specifically in any publications.
