Recombinant human CD226 protein (Active) (ab219701)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human CD226 protein (Active)
See all CD226 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
Immobilized ab219701 at 2 μg/mL (100 μL/well) can bind Human CD155, Fc tag with a linear range of 3.3-51.2 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHG MVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTW QKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKI QPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSG LYRCYLQASAGENETFVMRLTVAEGKTDN -
Predicted molecular weight
28 kDa including tags -
Amino acids
19 to 247 -
Tags
His tag C-Terminus -
Additional sequence information
(NP_006557).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219701 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from 0.22 µm filtered solution.
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- adhesion glycoprotein
- CD226
- CD226 antigen
see all -
Function
Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. -
Tissue specificity
Expressed by peripheral blood T-lymphocytes. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE analysis of reduced ab219701 stained overnight with Coomassie Blue.
-
Ab219701 at 3µg/ml can bind to 293T cell overexpressing human CD155 as dtermined by FACS assay.
-
Immobilized ab219701 at 2 μg/mL (100 μL/well) can bind Human CD155, Fc tag with a linear range of 3.3-51.2 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219701 has not yet been referenced specifically in any publications.