Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      HHHHHHHHDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQIS QELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLE RLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARY ACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSH VDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCT PPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
    • Molecular weight

      32 kDa including tags
    • Amino acids

      48 to 321
    • Tags

      His tag N-Terminus
    • Additional sequence information

      extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab215656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Blast 2
    • BLAST-2
    • Blast2
    • C type lectin domain family 4 member J
    • C-type lectin domain family 4
    • C-type lectin domain family 4 member J
    • C-type lectin domain family 4, member J
    • CD 23
    • CD 23A
    • CD23
    • CD23 antigen
    • CD23A
    • CLEC 4J
    • CLEC4J
    • Fc epsilon receptor II
    • Fc epsilon RII
    • Fc fragment of IgE
    • Fc fragment of IgE low affinity II receptor for
    • Fc fragment of IgE receptor II
    • Fc fragment of IgE, low affinity II, receptor for (CD23)
    • Fc of IgE
    • Fc of IgE, low affinity II, receptor for (CD23)
    • Fc receptor IgE low affinity II alpha polypeptide
    • Fc receptor, IgE, low affinity II, alpha polypeptide, isoform CRA_a
    • Fc-epsilon-RII
    • FCE 2
    • FCE2
    • FCER 2
    • Fcer2
    • FCER2_HUMAN
    • FCER2A
    • FceRII
    • IgE binding factor
    • IgE receptor lymphocyte
    • IgE-binding factor
    • IGEBF
    • Immunoglobulin E binding factor
    • Immunoglobulin E receptor
    • Immunoglobulin E receptor, low affinity II
    • Immunoglobulin E-binding factor
    • Immunoglobulin epsilon chain
    • LEUKOCYTE ANTIGEN CD23
    • Low Affinity IgE Receptor
    • Low affinity immunoglobulin epsilon Fc receptor
    • Low affinity immunoglobulin epsilon Fc receptor membrane bound form
    • Low affinity immunoglobulin epsilon Fc receptor soluble form
    • Ly-42
    • Ly42
    • Lymphocyte antigen CD23
    • Lymphocyte IgE receptor
    • MGC93219
    see all
  • Function

    This receptor has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Cell membrane. Secreted. Also exists as a soluble excreted form.
  • Information by UniProt

References

ab215656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up