Recombinant human CD252 protein (Fc Chimera Active) (ab206011)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGEL ILIHQNPGEFCVL
    • Molecular weight

      42 kDa including tags
    • Amino acids

      51 to 183
    • Additional sequence information

      Fc Chimera is fused with a Human IgG1 Fc tag at the N-terminus. NP_003317

Specifications

Our Abpromise guarantee covers the use of ab206011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. The EC50 is typically 2.2-19.7 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 µg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 134L
    • CD 252
    • CD134
    • CD134 ligand
    • CD134L
    • CD252
    • CD252 antigen
    • glycoprotein 34 kd
    • Glycoprotein Gp34
    • GP34
    • OX-40L
    • OX40 antigen ligand
    • OX40 ligand
    • OX40L
    • TAX transcriptionally-activated glycoprotein 1
    • TNFL4_HUMAN
    • Tnfsf4
    • Tumor necrosis factor (ligand) superfamily member 4
    • Tumor necrosis factor ligand superfamily member 4
    • TXGP1
    see all
  • Function

    Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
  • Involvement in disease

    Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • FACS assay shows that recombinant Human OX40 Ligand, Fc Tag can bind to 293T cell overexpressing human OX40. The concentration of OX40 Ligand used is 0.01 µg/ml.
  • Immobilized Human OX40, His Tag at 0.5 µg/mL (100 µl/well) can bind Human OX40 Ligand, Fc Tag with a linear range of 2-15 ng/mL.
  • SDS-PAGE analysis of reduced ab206011, staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 53 kDa in SDS-PAGE due to glycosylation.

References

ab206011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up