Recombinant human CD252 protein (Fc Chimera Active) (ab216219)

Description

  • Product name

    Recombinant human CD252 protein (Fc Chimera Active)
    See all CD252 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      51 to 183
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a (NP_003317).

Specifications

Our Abpromise guarantee covers the use of ab216219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilised from 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • CD 134L
    • CD 252
    • CD134
    • CD134 ligand
    • CD134L
    • CD252
    • CD252 antigen
    • glycoprotein 34 kd
    • Glycoprotein Gp34
    • GP34
    • OX-40L
    • OX40 antigen ligand
    • OX40 ligand
    • OX40L
    • TAX transcriptionally-activated glycoprotein 1
    • TNFL4_HUMAN
    • Tnfsf4
    • Tumor necrosis factor (ligand) superfamily member 4
    • Tumor necrosis factor ligand superfamily member 4
    • TXGP1
    see all
  • Function

    Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
  • Involvement in disease

    Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab216219 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up