Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPTPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIP GVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKEC TECDPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFR QLPARTLSTHWPPQRSLCSSDFIRLEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKHHHHHH
    • Molecular weight

      46 kDa including tags
    • Amino acids

      21 to 191
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused to hIgG-His-tag at C-terminus (NP_001233).

Specifications

Our Abpromise guarantee covers the use of ab219420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 85 % SDS-PAGE.
    ab219420 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD 27
    • CD27
    • CD27 antigen
    • CD27 molecule
    • CD27_HUMAN
    • CD27L receptor
    • LPFS2
    • MGC20393
    • OTTHUMP00000238557
    • S152
    • T cell activation antigen CD27
    • T cell antivation antigen S152
    • T-cell activation antigen CD27
    • T14
    • TNFRSF 7
    • TNFRSF7
    • TNFSF7
    • Tp 55
    • Tp55
    • Tumor necrosis factor receptor superfamily member 7
    see all
  • Function

    Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1.
  • Tissue specificity

    Found in most T-lymphocytes.
  • Sequence similarities

    Contains 3 TNFR-Cys repeats.
  • Post-translational
    modifications

    Phosphorylated and O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219420.

    Molecular Weight: 28-57 kDa (SDS–PAGE under reducing conditions).

References

ab219420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up