Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTGKQNELSDTAGREINLVDHHHHHH
    • Molecular weight

      15 kDa including tags
    • Amino acids

      31 to 150
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CD272

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • B and T lymphocyte associated protein
    • B and T lymphocyte attenuator
    • B and T lymphocyte associated
    • B- and T-lymphocyte attenuator
    • B- and T-lymphocyte-associated protein
    • BTLA
    • BTLA_HUMAN
    • BTLA1
    • CD272
    • CD272 antigen
    • FLJ16065
    • MGC129743
    see all
  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab152051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up