Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTDVKSASERPSKDEMASRPWLLYR
    • Molecular weight

      33 kDa
    • Amino acids

      31 to 157
    • Additional sequence information

      The extracellular domain is fused to the N erminus of the Fc region of Human IgG1. NP_861445.3

Specifications

Our Abpromise guarantee covers the use of ab214139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a competitive binding assay.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 0.600 Eu/µg
  • Purity

    >= 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CD272

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 99% PBS

    Lyophilized from 0.2µm-filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • B and T lymphocyte associated protein
    • B and T lymphocyte attenuator
    • B and T lymphocyte associated
    • B- and T-lymphocyte attenuator
    • B- and T-lymphocyte-associated protein
    • BTLA
    • BTLA_HUMAN
    • BTLA1
    • CD272
    • CD272 antigen
    • FLJ16065
    • MGC129743
    see all
  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up