Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTDVKSASERPSKDEMASRPWLLYR
    • Molecular weight

      15 kDa
    • Amino acids

      31 to 157
    • Additional sequence information

      The extracellular domain of Human CD272 fused to the N-terminus of the Fc region of mouse IgG2a. NCBI Accession No. NP_861445.3.

Specifications

Our Abpromise guarantee covers the use of ab214969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a competitive binding assay.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 0.060 Eu/µg
  • Purity

    > 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CD272

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µL sterile water. Add 1 × PBS to the desired protein concentration.

General Info

  • Alternative names

    • B and T lymphocyte associated protein
    • B and T lymphocyte attenuator
    • B and T lymphocyte associated
    • B- and T-lymphocyte attenuator
    • B- and T-lymphocyte-associated protein
    • BTLA
    • BTLA_HUMAN
    • BTLA1
    • CD272
    • CD272 antigen
    • FLJ16065
    • MGC129743
    see all
  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up