Bioactive grade

Recombinant human CD272/BTLA protein (Fc Chimera Active) (Biotin) (ab246021)

Description

  • Product name

    Recombinant human CD272/BTLA protein (Fc Chimera Active) (Biotin)
    See all CD272/BTLA proteins and peptides
  • Biological activity

    Immobilized human HVEM, Fc Tag at 10 μg/mL (100 μL/well) can bind ab246021 with a linear range of 0.3-5 μg/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVT
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      31 to 134
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CD272

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • B and T lymphocyte associated protein
    • B and T lymphocyte attenuator
    • B and T lymphocyte associated
    • B- and T-lymphocyte attenuator
    • B- and T-lymphocyte-associated protein
    • BTLA
    • BTLA_HUMAN
    • BTLA1
    • CD272
    • CD272 antigen
    • FLJ16065
    • MGC129743
    see all
  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized human HVEM, Fc Tag at 10 μg/mL (100 μL/well) can bind ab246021 with a linear range of 0.3-5 μg/mL.

  • SDS-PAGE - Recombinant human CD272/BTLA protein (Fc Chimera Active) (Biotin) (ab246021).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. The protein migrates as 55-66 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab246021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up