Recombinant human CD276 protein (Fc Chimera Active) (ab216204)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human CD276 protein (Fc Chimera Active)
See all CD276 proteins and peptides -
Biological activity
Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 5.000 Eu/mg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLV HSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSI RDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPV LQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGF SLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLR LQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPG DTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVL RVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT -
Predicted molecular weight
100 kDa including tags -
Amino acids
27 to 461 -
Additional sequence information
Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a (NP_001019907.1).
-
Specifications
Our Abpromise guarantee covers the use of ab216204 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute 100µg vial with 100 µl sterile water to a concentration of 1mg/ml. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- 4Ig B7 H3
- 4Ig-B7-H3
- AU016588
see all -
Function
May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling. -
Tissue specificity
Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophoblast cells and Hofbauer cells of the first trimester placenta and term placenta. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 2 Ig-like V-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
Datasheets and documents
References
ab216204 has not yet been referenced specifically in any publications.