Description

  • Product name

    Recombinant human CD28 protein (Active)
    See all CD28 proteins and peptides
  • Biological activity

    Determined by its ability to bind its principal binding partner (B7-1) in a functional ELISA.

  • Purity

    > 95 % SDS-PAGE.
    >95 % by HPLC analysis.
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVV YGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      41 kDa
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      Glycosylated, disulfide-linked homodimer of 734 aa residue whose monomer consists of the 134 aa length extracellular portion of CD28 fused to the 231 aa length Fc portion of human IgG1 by two glycines

Specifications

Our Abpromise guarantee covers the use of ab245796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1-1.0 mg/ml.

General Info

  • Alternative names

    • CD 28
    • CD28
    • CD28 antigen
    • CD28 molecule
    • CD28_HUMAN
    • MGC138290
    • T cell antigen CD28
    • T cell specific surface glycoprotein
    • T cell specific surface glycoprotein CD28
    • T-cell-specific surface glycoprotein CD28
    • TP44
    see all
  • Function

    Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
  • Tissue specificity

    Expressed in T-cells and plasma cells, but not in less mature B-cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab245796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up