Recombinant Human CD28 protein (Fc Chimera) (ab216187)

Overview

Description

  • Nature
    Recombinant
  • Source
    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVV YGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
    • Amino acids
      19 to 152
    • Additional sequence information
      Corresponding to the extracellular domain of human CD28 (aa 19-152) fused to the N-terminus of the Fc region of human IgG1.

Specifications

Our Abpromise guarantee covers the use of ab216187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.060 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names
    • CD 28
    • CD28
    • CD28 antigen
    • CD28 molecule
    • CD28_HUMAN
    • MGC138290
    • T cell antigen CD28
    • T cell specific surface glycoprotein
    • T cell specific surface glycoprotein CD28
    • T-cell-specific surface glycoprotein CD28
    • TP44
    see all
  • Function
    Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
  • Tissue specificity
    Expressed in T-cells and plasma cells, but not in less mature B-cells.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab216187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up