Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLN QEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVD NYWICKKPAA
    • Amino acids
      285 to 394
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C type lectin domain family 4, member M
    • C-type lectin domain family 4 member M
    • CD209 antigen like
    • CD209 antigen like protein 1
    • CD209 antigen-like protein 1
    • CD209L
    • CD209L1
    • CD299
    • CD299 antigen
    • CLC4M_HUMAN
    • CLEC4M
    • DC SIGN related protein
    • DC SIGN2
    • DC SIGNR
    • DC-SIGN-related protein
    • DC-SIGN2
    • DC-SIGNR
    • DCSIGN related protein
    • DCSIGNR
    • Dendritic cell-specific ICAM-3-grabbing non-integrin 2
    • HP10347
    • L SIGN
    • L-SIGN
    • Liver/lymph node specific ICAM3 grabbing nonintegrin
    • Liver/lymph node-specific ICAM-3-grabbing non-integrin
    • LSIGN
    • Mannose binding C type lectin DC SIGNR
    • MGC129964
    • MGC47866
    see all
  • Function
    Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a coreceptor for the SARS coronavirus.
  • Tissue specificity
    Predominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Domain
    The tandem repeat domain, also called neck domain, mediates oligomerization.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab160952 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up