Bioactive grade

Recombinant human CD3 epsilon + CD3D protein (Active) (ab221659)

Description

  • Product name

    Recombinant human CD3 epsilon + CD3D protein (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized OKT3 MAb at 5 μg/ml (100 μl/well) can bind ab221659 with a linear range of 0.625-5 μg/ml.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMD
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      23 to 126
    • Tags

      His tag C-Terminus
    • Additional sequence information

      CD3 epsilon extracellular domain.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIY RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
    • Predicted molecular weight

      14 kDa
    • Amino acids

      22 to 105
    • Additional sequence information

      CD3D extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab221659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    CD3 epsilon: Membrane. CD3D: Membrane.

Images

  • Human CD3E&CD3D Heterodimer Protein, His Tag&Tag Free on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Human CD3E&CD3D Heterodimer Protein, His Tag&Tag Free at 2 µg/mL (100 µL/well) can bind OKT3 (mouse IgG2a) with a linear range of 0.01-0.08 µg/mL.
  • Immobilized Mouse Anti-Human CD3 (SP34-2) at 5 µg/mL (100 µL/well) can bind Human CD3E&CD3D Heterodimer Protein, His Tag&Tag Free with a linear range of 0.3-5 ng/mL.
  • Reduced ab221659 analyzed by SDS-PAGE and stained overnight with Coomassie Blue.

    The protein migrates as 22 kDa and 24-32 kDa under reducing conditions due to glycosylation.

References

ab221659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Other
ab221659 was successfully used as an immunogen to generate anti-CD3e antibodies in mice. The success of the immunization was measured by ELISA using ab221659 as antigen.

Abcam user community

Verified customer

Submitted Oct 17 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up