Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMDVDHHHHHH
    • Molecular weight

      13 kDa including tags
    • Amino acids

      23 to 126
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • CD3 epsilon
    • CD3e
    • CD3E antigen epsilon polypeptide
    • CD3e antigen epsilon polypeptide (TiT3 complex)
    • CD3E antigen, epsilon subunit
    • CD3e molecule epsilon
    • CD3e molecule, epsilon (CD3 TCR complex)
    • CD3e molecule, epsilon (CD3-TCR complex)
    • CD3E_HUMAN
    • IMD18
    • T cell antigen receptor complex epsilon subunit of T3
    • T cell surface antigen T3/Leu 4 epsilon chain
    • T cell surface glycoprotein CD3 epsilon chain
    • T-cell surface antigen T3/Leu-4 epsilon chain
    • T-cell surface glycoprotein CD3 epsilon chain
    • T3E
    • TCRE
    see all
  • Function

    The CD3 complex mediates signal transduction.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab152088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up