Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Sequence
      DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMD
    • Molecular weight
      39 kDa including tags
    • Amino acids
      23 to 126
    • Tags
      His tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information
      Extracellular domain (NP_000724.1).
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKW NLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
    • Molecular weight
      39 kDa including tags
    • Amino acids
      23 to 116
    • Tags
      DDDDK tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information
      Extracellular domain (AAI13831).

Specifications

Our Abpromise guarantee covers the use of ab220577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized OKT3 MAb at 10 μg/mL (100 μL/well) can bind ab220577 with a linear range of 0.3-5 μg/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, PBS

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • 4930549J05Rik
    • A430104F18Rik
    • AW552088
    • Cd247
    • CD247 antigen
    • CD247 antigen, zeta subunit
    • CD247 molecule
    • CD3
    • CD3 antigen, delta subunit
    • CD3 delta
    • CD3 epsilon
    • CD3 eta
    • CD3 gamma
    • CD3 molecule delta polypeptide
    • CD3 molecule, epsilon polypeptide
    • CD3 molecule, gamma polypeptide
    • CD3 zeta
    • CD3-DELTA
    • CD3d
    • CD3D antigen delta polypeptide
    • CD3d antigen, delta polypeptide (TiT3 complex)
    • CD3d molecule delta
    • CD3d molecule delta CD3 TCR complex
    • CD3d molecule, delta (CD3-TCR complex)
    • CD3D_HUMAN
    • CD3E
    • CD3e antigen
    • CD3E antigen epsilon polypeptide
    • CD3e antigen, epsilon polypeptide (TiT3 complex)
    • CD3e molecule epsilon
    • CD3e molecule epsilon CD3 TCR complex
    • CD3e molecule, epsilon (CD3-TCR complex)
    • CD3epsilon
    • CD3G
    • CD3g antigen
    • CD3G antigen gamma polypeptide
    • CD3g antigen, gamma polypeptide (TiT3 complex)
    • CD3g molecule gamma
    • CD3g molecule gamma CD3 TCR complex
    • CD3g molecule, gamma (CD3-TCR complex)
    • CD3H
    • CD3Q
    • CD3Z
    • CD3zeta
    • Ctg3
    • FLJ17620
    • FLJ17664
    • FLJ18683
    • FLJ79544
    • FLJ94613
    • IMD19
    • Leu-4
    • MGC138597
    • OKT3, delta chain
    • OTTHUMP00000032544
    • T cell receptor
    • T cell receptor T3 delta chain
    • T cell receptor T3 gamma chain
    • T cell receptor T3 zeta chain
    • T cell receptor zeta chain
    • T cell surface glycoprotein CD3
    • T cell surface glycoprotein CD3 delta chain
    • T cell surface glycoprotein CD3 epsilon chain
    • T cell surface glycoprotein CD3 gamma chain
    • T cell surface glycoprotein CD3 zeta chain
    • T-cell antigen receptor complex, delta subunit of T3
    • T-cell antigen receptor complex, epsilon subunit of T3
    • T-cell antigen receptor complex, gamma subunit of T3
    • T-cell antigen receptor complex, zeta subunit of CD3
    • T-cell receptor T3 delta chain
    • T-cell receptor T3 gamma chain
    • T-cell surface antigen T3/Leu-4 epsilon chain
    • T-cell surface glycoprotein CD3 delta chain
    • T-cell surface glycoprotein CD3 gamma chain
    • T3
    • T3d
    • T3e
    • T3g
    • T3z
    • TCRE
    • TCRk
    • Tcrz
    • TCRzeta
    see all
  • Function
    The CD3 complex mediates signal transduction.
  • Involvement in disease
    Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities
    Contains 1 ITAM domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Immobilized OKT3 at 10 μg/mL (100 μL/well) binds ab220577.

    Linear range: 0.3-5 μg/mL (Routinely tested).

  • Immobilized Mouse Anti-Human CD3 at 5 μg/mL (100 μL/well) binds ab220577. 

    Linear range: 0.19-0.78 ng/mL (QC tested).

  • Anti-Human CD3 mAb (OKT3), Ultra-low endotoxin, captured on CM5 chip via anti-mouse antibodies surface,binds ab220577 with an affinity constant of 3.16 μM, as determined in an SPR assay (Biacore T200) (Routinely tested).

  • Mouse IgG1, captured on CM5 chip via anti-mouse antibodies surface, binds ab220577 with an affinity constant of 0.867 nM, as determined in an SPR assay (Biacore T200) (Routinely tested).

  • Reduced ab220577 on SDS-PAGE, stained overnight with Coomassie Blue.

    The purity of the protein is greater than 95%.

    The reducing heterodimer protein migrates as 40-50 kDa due to glycosylation.

References

ab220577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up