Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGG KPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA TKDTYDALHMQALPPRHHHHHH
    • Molecular weight

      14 kDa including tags
    • Amino acids

      52 to 164
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Cytoplasmic domain (NP_932170).

Specifications

Our Abpromise guarantee covers the use of ab229518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab229518 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.8
    Constituents: 0.32% Tris HCl, 50% Glycerol, 0.02% DTT, 0.03% EDTA, 0.58% Sodium chloride

General Info

  • Alternative names

    • 4930549J05Rik
    • A430104F18Rik
    • AW552088
    • Cd247
    • CD247 antigen
    • CD247 antigen, zeta subunit
    • CD247 molecule
    • CD3
    • CD3 antigen, delta subunit
    • CD3 delta
    • CD3 epsilon
    • CD3 eta
    • CD3 gamma
    • CD3 molecule delta polypeptide
    • CD3 molecule, epsilon polypeptide
    • CD3 molecule, gamma polypeptide
    • CD3 zeta
    • CD3-DELTA
    • CD3d
    • CD3D antigen delta polypeptide
    • CD3d antigen, delta polypeptide (TiT3 complex)
    • CD3d molecule delta
    • CD3d molecule delta CD3 TCR complex
    • CD3d molecule, delta (CD3-TCR complex)
    • CD3D_HUMAN
    • CD3E
    • CD3e antigen
    • CD3E antigen epsilon polypeptide
    • CD3e antigen, epsilon polypeptide (TiT3 complex)
    • CD3e molecule epsilon
    • CD3e molecule epsilon CD3 TCR complex
    • CD3e molecule, epsilon (CD3-TCR complex)
    • CD3epsilon
    • CD3G
    • CD3g antigen
    • CD3G antigen gamma polypeptide
    • CD3g antigen, gamma polypeptide (TiT3 complex)
    • CD3g molecule gamma
    • CD3g molecule gamma CD3 TCR complex
    • CD3g molecule, gamma (CD3-TCR complex)
    • CD3H
    • CD3Q
    • CD3Z
    • CD3zeta
    • Ctg3
    • FLJ17620
    • FLJ17664
    • FLJ18683
    • FLJ79544
    • FLJ94613
    • IMD19
    • Leu-4
    • MGC138597
    • OKT3, delta chain
    • OTTHUMP00000032544
    • T cell receptor
    • T cell receptor T3 delta chain
    • T cell receptor T3 gamma chain
    • T cell receptor T3 zeta chain
    • T cell receptor zeta chain
    • T cell surface antigen T3/Leu 4 epsilon chain
    • T cell surface glycoprotein CD3
    • T cell surface glycoprotein CD3 delta chain
    • T cell surface glycoprotein CD3 epsilon chain
    • T cell surface glycoprotein CD3 gamma chain
    • T cell surface glycoprotein CD3 zeta chain
    • T-cell antigen receptor complex, delta subunit of T3
    • T-cell antigen receptor complex, epsilon subunit of T3
    • T-cell antigen receptor complex, gamma subunit of T3
    • T-cell antigen receptor complex, zeta subunit of CD3
    • T-cell receptor T3 delta chain
    • T-cell receptor T3 gamma chain
    • T-cell surface antigen T3/Leu-4 epsilon chain
    • T-cell surface glycoprotein CD3 delta chain
    • T-cell surface glycoprotein CD3 epsilon chain
    • T-cell surface glycoprotein CD3 gamma chain
    • T3
    • T3d
    • T3e
    • T3g
    • T3z
    • TCRE
    • TCRk
    • Tcrz
    • TCRzeta
    see all
  • Function

    The CD3 complex mediates signal transduction.
  • Involvement in disease

    Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
  • Sequence similarities

    Contains 1 ITAM domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229518.

    MW: 13.5-18 kDa (SDS-PAGE under reducing conditions).

References

ab229518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up