Overview

  • Product name

    Recombinant Human CD3 zeta protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLG RREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGM KGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
    • Molecular weight

      15 kDa including tags
    • Amino acids

      62 to 164
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139254 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 4930549J05Rik
    • A430104F18Rik
    • AW552088
    • CD247
    • CD247 antigen
    • Cd247 molecule
    • Cd3
    • CD3 antigen, zeta polypeptide, isoform CRA_b
    • CD3 antigen, zeta subunit
    • CD3-eta
    • CD3H
    • CD3Q
    • Cd3z
    • CD3Z antigen zeta polypeptide (TiT3 complex)
    • CD3Z_HUMAN
    • CD3zeta
    • CD3zeta chain
    • MGC140430
    • T cell receptor T3 zeta chain
    • T cell surface glycoprotein CD3 zeta chain
    • T-cell antigen receptor complex, zeta subunit of CD3
    • T-cell receptor T3 zeta chain
    • T-cell surface glycoprotein CD3 zeta chain
    • T3z
    • TCR zeta chain
    • TCRk
    • TCRZ
    • TCRzeta
    see all
  • Function

    Probable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
  • Involvement in disease

    Defects in CD247 are the cause of immunodeficiency due to defect in CD3-zeta (CD3ZID) [MIM:610163]. An immunological deficiency characterized by T-cells impaired immune response to alloantigens, tetanus toxoid and mitogens.
  • Sequence similarities

    Belongs to the CD3Z/FCER1G family.
    Contains 3 ITAM domains.
  • Domain

    The ITAM domains mediate interaction with SHB.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues after T-cell receptor triggering.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139254.

References

ab139254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up